Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932
  1. Avatar for dpmattingly 31. dpmattingly Lv 1 30 pts. 9,915
  2. Avatar for Phyx 32. Phyx Lv 1 28 pts. 9,907
  3. Avatar for BootsMcGraw 33. BootsMcGraw Lv 1 27 pts. 9,871
  4. Avatar for Maerlyn138 34. Maerlyn138 Lv 1 26 pts. 9,860
  5. Avatar for stomjoh 35. stomjoh Lv 1 25 pts. 9,856
  6. Avatar for Deleted player 36. Deleted player pts. 9,856
  7. Avatar for Norrjane 37. Norrjane Lv 1 22 pts. 9,851
  8. Avatar for manu8170 38. manu8170 Lv 1 21 pts. 9,844
  9. Avatar for fpc 39. fpc Lv 1 20 pts. 9,840
  10. Avatar for drjr 40. drjr Lv 1 19 pts. 9,833

Comments