Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for AimeMedina 131. AimeMedina Lv 1 1 pt. 0
  2. Avatar for zwanggr 132. zwanggr Lv 1 1 pt. 0
  3. Avatar for puxatudo 133. puxatudo Lv 1 1 pt. 0
  4. Avatar for bkoep 134. bkoep Lv 1 1 pt. 0
  5. Avatar for nehar 135. nehar Lv 1 1 pt. 0
  6. Avatar for Sciren 136. Sciren Lv 1 1 pt. 0
  7. Avatar for rmoretti 137. rmoretti Lv 1 1 pt. 0
  8. Avatar for ivalnic 138. ivalnic Lv 1 1 pt. 0

Comments