Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932
  1. Avatar for heather-1 51. heather-1 Lv 1 11 pts. 9,473
  2. Avatar for fishercat 52. fishercat Lv 1 10 pts. 9,462
  3. Avatar for Bletchley Park 53. Bletchley Park Lv 1 10 pts. 9,433
  4. Avatar for argyrw 54. argyrw Lv 1 9 pts. 9,327
  5. Avatar for bamh 55. bamh Lv 1 9 pts. 9,307
  6. Avatar for nicobul 56. nicobul Lv 1 8 pts. 9,281
  7. Avatar for AlkiP0Ps 57. AlkiP0Ps Lv 1 8 pts. 9,260
  8. Avatar for Zepp 58. Zepp Lv 1 7 pts. 9,140
  9. Avatar for ShadowTactics 59. ShadowTactics Lv 1 7 pts. 9,069
  10. Avatar for maithra 60. maithra Lv 1 6 pts. 9,054

Comments