Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for harvardman 121. harvardman Lv 1 1 pt. 6,715
  2. Avatar for jflat06 122. jflat06 Lv 1 1 pt. 6,616
  3. Avatar for aspid 123. aspid Lv 1 1 pt. 5,941
  4. Avatar for ManVsYard 124. ManVsYard Lv 1 1 pt. 4,858
  5. Avatar for jaylyahely 125. jaylyahely Lv 1 1 pt. 4,484
  6. Avatar for O.R 126. O.R Lv 1 1 pt. 4,331
  7. Avatar for sullivjack03 127. sullivjack03 Lv 1 1 pt. 4,300
  8. Avatar for kanneganti 128. kanneganti Lv 1 1 pt. 4,300
  9. Avatar for Madison Des 129. Madison Des Lv 1 1 pt. 4,300
  10. Avatar for joshmiller 130. joshmiller Lv 1 1 pt. 4,300

Comments