Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for maithra 31. maithra Lv 1 29 pts. 9,487
  2. Avatar for BarrySampson 32. BarrySampson Lv 1 28 pts. 9,485
  3. Avatar for Maerlyn138 33. Maerlyn138 Lv 1 27 pts. 9,478
  4. Avatar for toshiue 34. toshiue Lv 1 25 pts. 9,434
  5. Avatar for alcor29 35. alcor29 Lv 1 24 pts. 9,408
  6. Avatar for bamh 36. bamh Lv 1 23 pts. 9,390
  7. Avatar for rezaefar 37. rezaefar Lv 1 22 pts. 9,341
  8. Avatar for infjamc 38. infjamc Lv 1 21 pts. 9,327
  9. Avatar for dpmattingly 39. dpmattingly Lv 1 20 pts. 9,325
  10. Avatar for vybi 40. vybi Lv 1 19 pts. 9,314

Comments