Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,910
  2. Avatar for Go Science 2. Go Science 71 pts. 9,848
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,801
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,708
  5. Avatar for Contenders 5. Contenders 22 pts. 9,683
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,671
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 9,664
  8. Avatar for Czech National Team 8. Czech National Team 5 pts. 9,314
  9. Avatar for Australia 9. Australia 3 pts. 9,310
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,260

  1. Avatar for maithra 31. maithra Lv 1 29 pts. 9,487
  2. Avatar for BarrySampson 32. BarrySampson Lv 1 28 pts. 9,485
  3. Avatar for Maerlyn138 33. Maerlyn138 Lv 1 27 pts. 9,478
  4. Avatar for toshiue 34. toshiue Lv 1 25 pts. 9,434
  5. Avatar for alcor29 35. alcor29 Lv 1 24 pts. 9,408
  6. Avatar for bamh 36. bamh Lv 1 23 pts. 9,390
  7. Avatar for rezaefar 37. rezaefar Lv 1 22 pts. 9,341
  8. Avatar for infjamc 38. infjamc Lv 1 21 pts. 9,327
  9. Avatar for dpmattingly 39. dpmattingly Lv 1 20 pts. 9,325
  10. Avatar for vybi 40. vybi Lv 1 19 pts. 9,314

Comments