Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for Vinara 41. Vinara Lv 1 18 pts. 9,312
  2. Avatar for Wiz kid 42. Wiz kid Lv 1 17 pts. 9,310
  3. Avatar for kyoota 43. kyoota Lv 1 16 pts. 9,306
  4. Avatar for Deet 44. Deet Lv 1 15 pts. 9,304
  5. Avatar for kentish_alex 45. kentish_alex Lv 1 15 pts. 9,270
  6. Avatar for fpc 46. fpc Lv 1 14 pts. 9,262
  7. Avatar for ShadowTactics 47. ShadowTactics Lv 1 13 pts. 9,260
  8. Avatar for BootsMcGraw 48. BootsMcGraw Lv 1 13 pts. 9,251
  9. Avatar for NeLikomSheet 49. NeLikomSheet Lv 1 12 pts. 9,243
  10. Avatar for zackallen 50. zackallen Lv 1 11 pts. 9,239

Comments