Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,910
  2. Avatar for Go Science 2. Go Science 71 pts. 9,848
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,801
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,708
  5. Avatar for Contenders 5. Contenders 22 pts. 9,683
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,671
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 9,664
  8. Avatar for Czech National Team 8. Czech National Team 5 pts. 9,314
  9. Avatar for Australia 9. Australia 3 pts. 9,310
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,260
  1. Avatar for Vinara 41. Vinara Lv 1 18 pts. 9,312
  2. Avatar for Wiz kid 42. Wiz kid Lv 1 17 pts. 9,310
  3. Avatar for kyoota 43. kyoota Lv 1 16 pts. 9,306
  4. Avatar for Deet 44. Deet Lv 1 15 pts. 9,304
  5. Avatar for kentish_alex 45. kentish_alex Lv 1 15 pts. 9,270
  6. Avatar for fpc 46. fpc Lv 1 14 pts. 9,262
  7. Avatar for ShadowTactics 47. ShadowTactics Lv 1 13 pts. 9,260
  8. Avatar for BootsMcGraw 48. BootsMcGraw Lv 1 13 pts. 9,251
  9. Avatar for NeLikomSheet 49. NeLikomSheet Lv 1 12 pts. 9,243
  10. Avatar for zackallen 50. zackallen Lv 1 11 pts. 9,239

Comments