Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for antibot215 71. antibot215 Lv 1 3 pts. 8,976
  2. Avatar for stomjoh 72. stomjoh Lv 1 3 pts. 8,945
  3. Avatar for dahast.de 73. dahast.de Lv 1 3 pts. 8,907
  4. Avatar for MrZanav 74. MrZanav Lv 1 3 pts. 8,882
  5. Avatar for argyrw 75. argyrw Lv 1 2 pts. 8,876
  6. Avatar for Mohoernchen 76. Mohoernchen Lv 1 2 pts. 8,855
  7. Avatar for tracybutt 77. tracybutt Lv 1 2 pts. 8,826
  8. Avatar for AlphaFold2 78. AlphaFold2 Lv 1 2 pts. 8,825
  9. Avatar for CharaLilith 79. CharaLilith Lv 1 2 pts. 8,822
  10. Avatar for kevin everington 80. kevin everington Lv 1 2 pts. 8,781

Comments