Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,910
  2. Avatar for Go Science 2. Go Science 71 pts. 9,848
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,801
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,708
  5. Avatar for Contenders 5. Contenders 22 pts. 9,683
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,671
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 9,664
  8. Avatar for Czech National Team 8. Czech National Team 5 pts. 9,314
  9. Avatar for Australia 9. Australia 3 pts. 9,310
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,260
  1. Avatar for antibot215 71. antibot215 Lv 1 3 pts. 8,976
  2. Avatar for stomjoh 72. stomjoh Lv 1 3 pts. 8,945
  3. Avatar for dahast.de 73. dahast.de Lv 1 3 pts. 8,907
  4. Avatar for MrZanav 74. MrZanav Lv 1 3 pts. 8,882
  5. Avatar for argyrw 75. argyrw Lv 1 2 pts. 8,876
  6. Avatar for Mohoernchen 76. Mohoernchen Lv 1 2 pts. 8,855
  7. Avatar for tracybutt 77. tracybutt Lv 1 2 pts. 8,826
  8. Avatar for AlphaFold2 78. AlphaFold2 Lv 1 2 pts. 8,825
  9. Avatar for CharaLilith 79. CharaLilith Lv 1 2 pts. 8,822
  10. Avatar for kevin everington 80. kevin everington Lv 1 2 pts. 8,781

Comments