Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094
  1. Avatar for Zosa 91. Zosa Lv 1 1 pt. 8,265
  2. Avatar for frostschutz 92. frostschutz Lv 1 1 pt. 8,253
  3. Avatar for zeripath 93. zeripath Lv 1 1 pt. 8,163
  4. Avatar for argyrw 94. argyrw Lv 1 1 pt. 8,118
  5. Avatar for thattemperature 95. thattemperature Lv 1 1 pt. 8,058
  6. Avatar for JOE.CADILLAC555 96. JOE.CADILLAC555 Lv 1 1 pt. 8,016
  7. Avatar for Borets 97. Borets Lv 1 1 pt. 8,007
  8. Avatar for Jenot96 98. Jenot96 Lv 1 1 pt. 7,996
  9. Avatar for FRANZAPP 99. FRANZAPP Lv 1 1 pt. 7,962
  10. Avatar for artsyambie6 100. artsyambie6 Lv 1 1 pt. 7,929

Comments