Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336
  1. Avatar for Zosa 91. Zosa Lv 1 1 pt. 8,265
  2. Avatar for frostschutz 92. frostschutz Lv 1 1 pt. 8,253
  3. Avatar for zeripath 93. zeripath Lv 1 1 pt. 8,163
  4. Avatar for argyrw 94. argyrw Lv 1 1 pt. 8,118
  5. Avatar for thattemperature 95. thattemperature Lv 1 1 pt. 8,058
  6. Avatar for JOE.CADILLAC555 96. JOE.CADILLAC555 Lv 1 1 pt. 8,016
  7. Avatar for Borets 97. Borets Lv 1 1 pt. 8,007
  8. Avatar for Jenot96 98. Jenot96 Lv 1 1 pt. 7,996
  9. Avatar for FRANZAPP 99. FRANZAPP Lv 1 1 pt. 7,962
  10. Avatar for artsyambie6 100. artsyambie6 Lv 1 1 pt. 7,929

Comments