Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094
  1. Avatar for gianbomb 101. gianbomb Lv 1 1 pt. 7,917
  2. Avatar for Alex_Alex 102. Alex_Alex Lv 1 1 pt. 7,900
  3. Avatar for HappyDuck 103. HappyDuck Lv 1 1 pt. 7,806
  4. Avatar for Belle36 104. Belle36 Lv 1 1 pt. 7,803
  5. Avatar for Amaris 105. Amaris Lv 1 1 pt. 7,780
  6. Avatar for Ikuso 106. Ikuso Lv 1 1 pt. 7,778
  7. Avatar for furi0us 107. furi0us Lv 1 1 pt. 7,747
  8. Avatar for cjddig 108. cjddig Lv 1 1 pt. 7,744
  9. Avatar for EZ2001 109. EZ2001 Lv 1 1 pt. 7,742
  10. Avatar for xuebingchen 110. xuebingchen Lv 1 1 pt. 7,725

Comments