Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Marvin's bunch 100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336

  1. Avatar for gianbomb 101. gianbomb Lv 1 1 pt. 7,917
  2. Avatar for Alex_Alex 102. Alex_Alex Lv 1 1 pt. 7,900
  3. Avatar for HappyDuck 103. HappyDuck Lv 1 1 pt. 7,806
  4. Avatar for Belle36 104. Belle36 Lv 1 1 pt. 7,803
  5. Avatar for Amaris 105. Amaris Lv 1 1 pt. 7,780
  6. Avatar for Ikuso 106. Ikuso Lv 1 1 pt. 7,778
  7. Avatar for furi0us 107. furi0us Lv 1 1 pt. 7,747
  8. Avatar for cjddig 108. cjddig Lv 1 1 pt. 7,744
  9. Avatar for EZ2001 109. EZ2001 Lv 1 1 pt. 7,742
  10. Avatar for xuebingchen 110. xuebingchen Lv 1 1 pt. 7,725

Comments