Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094

  1. Avatar for grogar7 11. grogar7 Lv 1 69 pts. 10,846
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 66 pts. 10,827
  3. Avatar for jobo0502 13. jobo0502 Lv 1 64 pts. 10,820
  4. Avatar for gmn 14. gmn Lv 1 61 pts. 10,810
  5. Avatar for MicElephant 15. MicElephant Lv 1 59 pts. 10,804
  6. Avatar for jausmh 16. jausmh Lv 1 57 pts. 10,789
  7. Avatar for Deleted player 17. Deleted player 54 pts. 10,719
  8. Avatar for Vinara 18. Vinara Lv 1 52 pts. 10,679
  9. Avatar for silent gene 19. silent gene Lv 1 50 pts. 10,636
  10. Avatar for g_b 20. g_b Lv 1 48 pts. 10,620

Comments