Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336
  1. Avatar for grogar7 11. grogar7 Lv 1 69 pts. 10,846
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 66 pts. 10,827
  3. Avatar for jobo0502 13. jobo0502 Lv 1 64 pts. 10,820
  4. Avatar for gmn 14. gmn Lv 1 61 pts. 10,810
  5. Avatar for MicElephant 15. MicElephant Lv 1 59 pts. 10,804
  6. Avatar for jausmh 16. jausmh Lv 1 57 pts. 10,789
  7. Avatar for Deleted player 17. Deleted player 54 pts. 10,719
  8. Avatar for Vinara 18. Vinara Lv 1 52 pts. 10,679
  9. Avatar for silent gene 19. silent gene Lv 1 50 pts. 10,636
  10. Avatar for g_b 20. g_b Lv 1 48 pts. 10,620

Comments