Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094
  1. Avatar for fishercat 61. fishercat Lv 1 6 pts. 9,207
  2. Avatar for Hellcat6 62. Hellcat6 Lv 1 6 pts. 9,189
  3. Avatar for PeterDav 63. PeterDav Lv 1 5 pts. 9,138
  4. Avatar for zackallen 64. zackallen Lv 1 5 pts. 9,117
  5. Avatar for Trajan464 65. Trajan464 Lv 1 5 pts. 9,082
  6. Avatar for antibot215 66. antibot215 Lv 1 5 pts. 9,063
  7. Avatar for drumpeter18yrs9yrs 67. drumpeter18yrs9yrs Lv 1 4 pts. 8,977
  8. Avatar for kevin everington 68. kevin everington Lv 1 4 pts. 8,842
  9. Avatar for DScott 69. DScott Lv 1 4 pts. 8,835
  10. Avatar for Stromkarls Zheng 70. Stromkarls Zheng Lv 1 4 pts. 8,783

Comments