Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336
  1. Avatar for fishercat 61. fishercat Lv 1 6 pts. 9,207
  2. Avatar for Hellcat6 62. Hellcat6 Lv 1 6 pts. 9,189
  3. Avatar for PeterDav 63. PeterDav Lv 1 5 pts. 9,138
  4. Avatar for zackallen 64. zackallen Lv 1 5 pts. 9,117
  5. Avatar for Trajan464 65. Trajan464 Lv 1 5 pts. 9,082
  6. Avatar for antibot215 66. antibot215 Lv 1 5 pts. 9,063
  7. Avatar for drumpeter18yrs9yrs 67. drumpeter18yrs9yrs Lv 1 4 pts. 8,977
  8. Avatar for kevin everington 68. kevin everington Lv 1 4 pts. 8,842
  9. Avatar for DScott 69. DScott Lv 1 4 pts. 8,835
  10. Avatar for Stromkarls Zheng 70. Stromkarls Zheng Lv 1 4 pts. 8,783

Comments