Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094

  1. Avatar for vybi 71. vybi Lv 1 3 pts. 8,783
  2. Avatar for rinze 72. rinze Lv 1 3 pts. 8,739
  3. Avatar for Dr.Sillem 73. Dr.Sillem Lv 1 3 pts. 8,718
  4. Avatar for Edith.Qxr 74. Edith.Qxr Lv 1 3 pts. 8,716
  5. Avatar for abiogenesis 75. abiogenesis Lv 1 3 pts. 8,706
  6. Avatar for borattt 76. borattt Lv 1 2 pts. 8,689
  7. Avatar for Kiwegapa 77. Kiwegapa Lv 1 2 pts. 8,677
  8. Avatar for Todd6485577 78. Todd6485577 Lv 1 2 pts. 8,669
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 2 pts. 8,648
  10. Avatar for RyeSnake 80. RyeSnake Lv 1 2 pts. 8,600

Comments