Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Marvin's bunch 100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336

  1. Avatar for vybi 71. vybi Lv 1 3 pts. 8,783
  2. Avatar for rinze 72. rinze Lv 1 3 pts. 8,739
  3. Avatar for Dr.Sillem 73. Dr.Sillem Lv 1 3 pts. 8,718
  4. Avatar for Edith.Qxr 74. Edith.Qxr Lv 1 3 pts. 8,716
  5. Avatar for abiogenesis 75. abiogenesis Lv 1 3 pts. 8,706
  6. Avatar for borattt 76. borattt Lv 1 2 pts. 8,689
  7. Avatar for Kiwegapa 77. Kiwegapa Lv 1 2 pts. 8,677
  8. Avatar for Todd6485577 78. Todd6485577 Lv 1 2 pts. 8,669
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 2 pts. 8,648
  10. Avatar for RyeSnake 80. RyeSnake Lv 1 2 pts. 8,600

Comments