Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336
  1. Avatar for Sakai Izumi 121. Sakai Izumi Lv 1 1 pt. 6,665
  2. Avatar for 01010011111 122. 01010011111 Lv 1 1 pt. 6,612
  3. Avatar for rmoretti 123. rmoretti Lv 1 1 pt. 6,313
  4. Avatar for AJ_MATSE 124. AJ_MATSE Lv 1 1 pt. 4,308
  5. Avatar for hepatic encephalophathy 125. hepatic encephalophathy Lv 1 1 pt. 4,200
  6. Avatar for AmyKendrick518 126. AmyKendrick518 Lv 1 1 pt. 4,102
  7. Avatar for hitemth 127. hitemth Lv 1 1 pt. 4,094
  8. Avatar for bkoep 128. bkoep Lv 1 1 pt. 4,094
  9. Avatar for Amy6 129. Amy6 Lv 1 1 pt. 4,094
  10. Avatar for Essipett 130. Essipett Lv 1 1 pt. 4,094

Comments