Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336
  1. Avatar for MrZanav 41. MrZanav Lv 1 18 pts. 10,089
  2. Avatar for kentish_alex 42. kentish_alex Lv 1 17 pts. 9,977
  3. Avatar for infjamc 43. infjamc Lv 1 17 pts. 9,955
  4. Avatar for Deleted player 44. Deleted player pts. 9,949
  5. Avatar for szinr 45. szinr Lv 1 15 pts. 9,945
  6. Avatar for ShadowTactics 46. ShadowTactics Lv 1 14 pts. 9,941
  7. Avatar for alcor29 47. alcor29 Lv 1 13 pts. 9,929
  8. Avatar for Oransche 48. Oransche Lv 1 13 pts. 9,851
  9. Avatar for pfirth 49. pfirth Lv 1 12 pts. 9,790
  10. Avatar for zippyc137 50. zippyc137 Lv 1 11 pts. 9,743

Comments