Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,259
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,251
  3. Avatar for Contenders 3. Contenders 49 pts. 11,100
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 11,062
  5. Avatar for Go Science 5. Go Science 22 pts. 10,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,945
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,219
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 9,941
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 9,371
  10. Avatar for Australia 10. Australia 2 pts. 9,336
  1. Avatar for simitimi 51. simitimi Lv 1 11 pts. 9,626
  2. Avatar for maithra 52. maithra Lv 1 10 pts. 9,509
  3. Avatar for kyoota 53. kyoota Lv 1 10 pts. 9,449
  4. Avatar for rezaefar 54. rezaefar Lv 1 9 pts. 9,394
  5. Avatar for AlphaFold2 55. AlphaFold2 Lv 1 9 pts. 9,371
  6. Avatar for Wiz kid 56. Wiz kid Lv 1 8 pts. 9,336
  7. Avatar for Larini 57. Larini Lv 1 8 pts. 9,329
  8. Avatar for bamh 58. bamh Lv 1 7 pts. 9,292
  9. Avatar for AlkiP0Ps 59. AlkiP0Ps Lv 1 7 pts. 9,280
  10. Avatar for Merf 60. Merf Lv 1 6 pts. 9,244

Comments