Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,119
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,113
  3. Avatar for Go Science 3. Go Science 52 pts. 9,096
  4. Avatar for Contenders 4. Contenders 36 pts. 9,053
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,014
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 8,993
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 8,867
  8. Avatar for AlphaFold 8. AlphaFold 6 pts. 8,822
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 8,777
  10. Avatar for Australia 10. Australia 2 pts. 8,748
  1. Avatar for furi0us 111. furi0us Lv 1 1 pt. 7,216
  2. Avatar for aorozzubas 112. aorozzubas Lv 1 1 pt. 7,024
  3. Avatar for jflat06 113. jflat06 Lv 1 1 pt. 6,852
  4. Avatar for isaksson 114. isaksson Lv 1 1 pt. 6,810
  5. Avatar for TSTL 115. TSTL Lv 1 1 pt. 4,755
  6. Avatar for r3dl0f 116. r3dl0f Lv 1 1 pt. 4,587
  7. Avatar for manuel0001 117. manuel0001 Lv 1 1 pt. 4,238
  8. Avatar for schli21 118. schli21 Lv 1 1 pt. 3,852
  9. Avatar for trialfoldit 119. trialfoldit Lv 1 1 pt. 3,852
  10. Avatar for liyongxiang 120. liyongxiang Lv 1 1 pt. 3,852

Comments