Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Beta Folders 100 pts. 9,119
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,113
  3. Avatar for Go Science 3. Go Science 52 pts. 9,096
  4. Avatar for Contenders 4. Contenders 36 pts. 9,053
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,014
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 8,993
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 8,867
  8. Avatar for AlphaFold 8. AlphaFold 6 pts. 8,822
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 8,777
  10. Avatar for Australia 10. Australia 2 pts. 8,748

  1. Avatar for heather-1 71. heather-1 Lv 1 2 pts. 8,471
  2. Avatar for fpc 72. fpc Lv 1 2 pts. 8,469
  3. Avatar for chrisb41 73. chrisb41 Lv 1 2 pts. 8,450
  4. Avatar for Arne Heessels 74. Arne Heessels Lv 1 2 pts. 8,444
  5. Avatar for kevin everington 75. kevin everington Lv 1 1 pt. 8,430
  6. Avatar for rinze 76. rinze Lv 1 1 pt. 8,408
  7. Avatar for MrZanav 77. MrZanav Lv 1 1 pt. 8,406
  8. Avatar for Idiotboy 78. Idiotboy Lv 1 1 pt. 8,404
  9. Avatar for abiogenesis 79. abiogenesis Lv 1 1 pt. 8,397
  10. Avatar for zackallen 80. zackallen Lv 1 1 pt. 8,391

Comments