Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278
  1. Avatar for Vinara 41. Vinara Lv 1 18 pts. 10,932
  2. Avatar for NeLikomSheet 42. NeLikomSheet Lv 1 17 pts. 10,913
  3. Avatar for AlphaFold2 43. AlphaFold2 Lv 1 17 pts. 10,908
  4. Avatar for equilibria 44. equilibria Lv 1 16 pts. 10,906
  5. Avatar for fiendish_ghoul 45. fiendish_ghoul Lv 1 15 pts. 10,903
  6. Avatar for rezaefar 46. rezaefar Lv 1 14 pts. 10,891
  7. Avatar for jausmh 47. jausmh Lv 1 13 pts. 10,882
  8. Avatar for zackallen 48. zackallen Lv 1 13 pts. 10,881
  9. Avatar for bamh 49. bamh Lv 1 12 pts. 10,871
  10. Avatar for zippyc137 50. zippyc137 Lv 1 11 pts. 10,839

Comments