Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,358
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,312
  3. Avatar for Marvin's bunch 3. Marvin's bunch 49 pts. 11,311
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,307
  5. Avatar for Contenders 5. Contenders 22 pts. 11,303
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,280
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 11,208
  8. Avatar for AlphaFold 8. AlphaFold 5 pts. 10,908
  9. Avatar for Australia 9. Australia 3 pts. 10,748
  10. Avatar for WISE 380 Spring 21 A 10. WISE 380 Spring 21 A 2 pts. 10,709
  1. Avatar for Vinara 41. Vinara Lv 1 18 pts. 10,932
  2. Avatar for NeLikomSheet 42. NeLikomSheet Lv 1 17 pts. 10,913
  3. Avatar for AlphaFold2 43. AlphaFold2 Lv 1 17 pts. 10,908
  4. Avatar for equilibria 44. equilibria Lv 1 16 pts. 10,906
  5. Avatar for fiendish_ghoul 45. fiendish_ghoul Lv 1 15 pts. 10,903
  6. Avatar for rezaefar 46. rezaefar Lv 1 14 pts. 10,891
  7. Avatar for jausmh 47. jausmh Lv 1 13 pts. 10,882
  8. Avatar for zackallen 48. zackallen Lv 1 13 pts. 10,881
  9. Avatar for bamh 49. bamh Lv 1 12 pts. 10,871
  10. Avatar for zippyc137 50. zippyc137 Lv 1 11 pts. 10,839

Comments