Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278
  1. Avatar for Chanwoo_Park 61. Chanwoo_Park Lv 1 6 pts. 10,674
  2. Avatar for Trajan464 62. Trajan464 Lv 1 6 pts. 10,661
  3. Avatar for I AM NOT supanut 63. I AM NOT supanut Lv 1 5 pts. 10,659
  4. Avatar for heather-1 64. heather-1 Lv 1 5 pts. 10,655
  5. Avatar for CharaLilith 65. CharaLilith Lv 1 5 pts. 10,633
  6. Avatar for abiogenesis 66. abiogenesis Lv 1 5 pts. 10,628
  7. Avatar for argyrw 67. argyrw Lv 1 4 pts. 10,624
  8. Avatar for vybi 68. vybi Lv 1 4 pts. 10,614
  9. Avatar for Hellcat6 69. Hellcat6 Lv 1 4 pts. 10,603
  10. Avatar for AlkiP0Ps 70. AlkiP0Ps Lv 1 4 pts. 10,577

Comments