Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Go Science 100 pts. 11,358
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,312
  3. Avatar for Marvin's bunch 3. Marvin's bunch 49 pts. 11,311
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,307
  5. Avatar for Contenders 5. Contenders 22 pts. 11,303
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,280
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 11,208
  8. Avatar for AlphaFold 8. AlphaFold 5 pts. 10,908
  9. Avatar for Australia 9. Australia 3 pts. 10,748
  10. Avatar for WISE 380 Spring 21 A 10. WISE 380 Spring 21 A 2 pts. 10,709

  1. Avatar for Chanwoo_Park 61. Chanwoo_Park Lv 1 6 pts. 10,674
  2. Avatar for Trajan464 62. Trajan464 Lv 1 6 pts. 10,661
  3. Avatar for I AM NOT supanut 63. I AM NOT supanut Lv 1 5 pts. 10,659
  4. Avatar for heather-1 64. heather-1 Lv 1 5 pts. 10,655
  5. Avatar for CharaLilith 65. CharaLilith Lv 1 5 pts. 10,633
  6. Avatar for abiogenesis 66. abiogenesis Lv 1 5 pts. 10,628
  7. Avatar for argyrw 67. argyrw Lv 1 4 pts. 10,624
  8. Avatar for vybi 68. vybi Lv 1 4 pts. 10,614
  9. Avatar for Hellcat6 69. Hellcat6 Lv 1 4 pts. 10,603
  10. Avatar for AlkiP0Ps 70. AlkiP0Ps Lv 1 4 pts. 10,577

Comments