Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Go Science 100 pts. 11,358
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,312
  3. Avatar for Marvin's bunch 3. Marvin's bunch 49 pts. 11,311
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,307
  5. Avatar for Contenders 5. Contenders 22 pts. 11,303
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,280
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 11,208
  8. Avatar for AlphaFold 8. AlphaFold 5 pts. 10,908
  9. Avatar for Australia 9. Australia 3 pts. 10,748
  10. Avatar for WISE 380 Spring 21 A 10. WISE 380 Spring 21 A 2 pts. 10,709

  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 46 pts. 11,167
  2. Avatar for maithra 22. maithra Lv 1 44 pts. 11,145
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 42 pts. 11,135
  4. Avatar for ucad 24. ucad Lv 1 40 pts. 11,114
  5. Avatar for eusair 25. eusair Lv 1 39 pts. 11,057
  6. Avatar for Lotus23 26. Lotus23 Lv 1 37 pts. 11,051
  7. Avatar for akaaka 27. akaaka Lv 1 35 pts. 11,017
  8. Avatar for PeterDav 28. PeterDav Lv 1 34 pts. 11,001
  9. Avatar for Todd6485577 29. Todd6485577 Lv 1 32 pts. 10,998
  10. Avatar for alcor29 30. alcor29 Lv 1 31 pts. 10,998

Comments