Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,789
  2. Avatar for Go Science 2. Go Science 70 pts. 9,786
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,748
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,720
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 9,704
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 9,674
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,445
  9. Avatar for Australia 9. Australia 2 pts. 9,393
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,258
  1. Avatar for evifnoskcaj 101. evifnoskcaj Lv 1 1 pt. 7,775
  2. Avatar for Merf 102. Merf Lv 1 1 pt. 7,761
  3. Avatar for furi0us 103. furi0us Lv 1 1 pt. 7,756
  4. Avatar for Lazgrind 104. Lazgrind Lv 1 1 pt. 7,752
  5. Avatar for 75EMILIEN75 105. 75EMILIEN75 Lv 1 1 pt. 7,693
  6. Avatar for johnsonphan76 106. johnsonphan76 Lv 1 1 pt. 7,688
  7. Avatar for Mister Twister 107. Mister Twister Lv 1 1 pt. 7,681
  8. Avatar for yujinb 108. yujinb Lv 1 1 pt. 7,678
  9. Avatar for rmoretti 109. rmoretti Lv 1 1 pt. 7,668
  10. Avatar for Rorym01 110. Rorym01 Lv 1 1 pt. 7,605

Comments