Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,789
  2. Avatar for Go Science 2. Go Science 70 pts. 9,786
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,748
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,720
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 9,704
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 9,674
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,445
  9. Avatar for Australia 9. Australia 2 pts. 9,393
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,258
  1. Avatar for hada 111. hada Lv 1 1 pt. 7,445
  2. Avatar for CHT35 112. CHT35 Lv 1 1 pt. 7,395
  3. Avatar for boboviz 113. boboviz Lv 1 1 pt. 7,328
  4. Avatar for Anna_K 114. Anna_K Lv 1 1 pt. 7,328
  5. Avatar for 622332uu 115. 622332uu Lv 1 1 pt. 7,319
  6. Avatar for Rick0930 116. Rick0930 Lv 1 1 pt. 7,143
  7. Avatar for lobsteroidz 117. lobsteroidz Lv 1 1 pt. 6,692
  8. Avatar for audreyydouglas 118. audreyydouglas Lv 1 1 pt. 5,995
  9. Avatar for Islxxawc 119. Islxxawc Lv 1 1 pt. 1,559
  10. Avatar for DrStrange22 120. DrStrange22 Lv 1 1 pt. 1,078

Comments