Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 8,488
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,415
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 7,998
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,603
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,509
  6. Avatar for StueveBio 16. StueveBio 1 pt. 5,875
  7. Avatar for Window Group 17. Window Group 1 pt. 5,610
  8. Avatar for test_group1 18. test_group1 1 pt. 668
  9. Avatar for Deleted group 19. Deleted group pts. 668
  1. Avatar for 34toco 141. 34toco Lv 1 1 pt. 6,429
  2. Avatar for harvardman 142. harvardman Lv 1 1 pt. 6,383
  3. Avatar for Alejandro3213 143. Alejandro3213 Lv 1 1 pt. 6,380
  4. Avatar for Jonnatan Avi 144. Jonnatan Avi Lv 1 1 pt. 6,377
  5. Avatar for Vicente23 145. Vicente23 Lv 1 1 pt. 6,370
  6. Avatar for leonelzxc 146. leonelzxc Lv 1 1 pt. 6,348
  7. Avatar for elkorbo 147. elkorbo Lv 1 1 pt. 6,110
  8. Avatar for Kraqun 148. Kraqun Lv 1 1 pt. 5,995
  9. Avatar for haneol yang 149. haneol yang Lv 1 1 pt. 5,875
  10. Avatar for Anson_69 150. Anson_69 Lv 1 1 pt. 5,638

Comments