Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851
  1. Avatar for Beany 91. Beany Lv 1 4 pts. 7,763
  2. Avatar for carxo 92. carxo Lv 1 4 pts. 7,669
  3. Avatar for creativspelerr 93. creativspelerr Lv 1 3 pts. 7,656
  4. Avatar for aendgraend 94. aendgraend Lv 1 3 pts. 7,603
  5. Avatar for kaylut 95. kaylut Lv 1 3 pts. 7,516
  6. Avatar for rinze 96. rinze Lv 1 3 pts. 7,389
  7. Avatar for vinsi 97. vinsi Lv 1 3 pts. 7,341
  8. Avatar for cjw_o3o 98. cjw_o3o Lv 1 3 pts. 7,318
  9. Avatar for Kimyoungjoon1105 99. Kimyoungjoon1105 Lv 1 3 pts. 7,317
  10. Avatar for Asce 100. Asce Lv 1 2 pts. 7,273

Comments