Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851
  1. Avatar for CHT35 101. CHT35 Lv 1 2 pts. 7,254
  2. Avatar for Galims 102. Galims Lv 1 2 pts. 7,221
  3. Avatar for tomas.v 103. tomas.v Lv 1 2 pts. 7,086
  4. Avatar for EJSON 104. EJSON Lv 1 2 pts. 7,049
  5. Avatar for tetra5 105. tetra5 Lv 1 2 pts. 7,048
  6. Avatar for Dapumar398 106. Dapumar398 Lv 1 2 pts. 7,028
  7. Avatar for soshimee 107. soshimee Lv 1 2 pts. 7,026
  8. Avatar for lee junha 108. lee junha Lv 1 2 pts. 7,020
  9. Avatar for Atlantis192 109. Atlantis192 Lv 1 2 pts. 7,005
  10. Avatar for ANDRESPR 110. ANDRESPR Lv 1 2 pts. 6,991

Comments