Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851
  1. Avatar for Daniel Munioz 81. Daniel Munioz Lv 1 6 pts. 8,201
  2. Avatar for multaq 82. multaq Lv 1 6 pts. 8,124
  3. Avatar for piia600 83. piia600 Lv 1 6 pts. 8,110
  4. Avatar for rmsthstlf 84. rmsthstlf Lv 1 5 pts. 8,017
  5. Avatar for vybi 85. vybi Lv 1 5 pts. 7,998
  6. Avatar for kevin everington 86. kevin everington Lv 1 5 pts. 7,966
  7. Avatar for Arne Heessels 87. Arne Heessels Lv 1 5 pts. 7,885
  8. Avatar for Drivingskunk 88. Drivingskunk Lv 1 4 pts. 7,857
  9. Avatar for marianelo1000 89. marianelo1000 Lv 1 4 pts. 7,823
  10. Avatar for Mohoernchen 90. Mohoernchen Lv 1 4 pts. 7,804

Comments