Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516
  1. Avatar for Sprites20 141. Sprites20 Lv 1 1 pt. 7,637
  2. Avatar for darekk 142. darekk Lv 1 1 pt. 7,574
  3. Avatar for andiesinger 143. andiesinger Lv 1 1 pt. 7,435
  4. Avatar for bkoep 144. bkoep Lv 1 1 pt. 7,426
  5. Avatar for MrMag0o0 145. MrMag0o0 Lv 1 1 pt. 7,377
  6. Avatar for kerruan 146. kerruan Lv 1 1 pt. 7,365
  7. Avatar for cleopatra 147. cleopatra Lv 1 1 pt. 7,339
  8. Avatar for kinase99 148. kinase99 Lv 1 1 pt. 7,315
  9. Avatar for Rose621 149. Rose621 Lv 1 1 pt. 7,249
  10. Avatar for furi0us 150. furi0us Lv 1 1 pt. 7,234

Comments