Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516
  1. Avatar for pzh666 151. pzh666 Lv 1 1 pt. 7,230
  2. Avatar for siraprem 152. siraprem Lv 1 1 pt. 7,219
  3. Avatar for 01010011111 153. 01010011111 Lv 1 1 pt. 7,199
  4. Avatar for yazid_13 154. yazid_13 Lv 1 1 pt. 7,157
  5. Avatar for drjr 155. drjr Lv 1 1 pt. 6,837
  6. Avatar for jflat06 156. jflat06 Lv 1 1 pt. 6,794
  7. Avatar for baltx 157. baltx Lv 1 1 pt. 6,359
  8. Avatar for TokyoTF 158. TokyoTF Lv 1 1 pt. 5,633
  9. Avatar for miguel7997 159. miguel7997 Lv 1 1 pt. 5,623
  10. Avatar for jerry26 160. jerry26 Lv 1 1 pt. 5,622

Comments