Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516
  1. Avatar for Tu.pap 161. Tu.pap Lv 1 1 pt. 5,615
  2. Avatar for yair llano 162. yair llano Lv 1 1 pt. 5,596
  3. Avatar for Yoshima 163. Yoshima Lv 1 1 pt. 5,579
  4. Avatar for Sushi_OwO_dog 164. Sushi_OwO_dog Lv 1 1 pt. 5,531
  5. Avatar for KJ100220 165. KJ100220 Lv 1 1 pt. 5,513
  6. Avatar for azazo 166. azazo Lv 1 1 pt. 5,439
  7. Avatar for 1diasinti 167. 1diasinti Lv 1 1 pt. 5,406
  8. Avatar for lilbob2619 168. lilbob2619 Lv 1 1 pt. 5,374
  9. Avatar for Knach 169. Knach Lv 1 1 pt. 5,340
  10. Avatar for sami1025 170. sami1025 Lv 1 1 pt. 5,286

Comments