Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241
  1. Avatar for Shortbread 71. Shortbread Lv 1 7 pts. 9,781
  2. Avatar for dahast.de 72. dahast.de Lv 1 7 pts. 9,757
  3. Avatar for Gerom 73. Gerom Lv 1 7 pts. 9,747
  4. Avatar for zannipietro 74. zannipietro Lv 1 6 pts. 9,731
  5. Avatar for kyoota 75. kyoota Lv 1 6 pts. 9,712
  6. Avatar for Dr.Sillem 76. Dr.Sillem Lv 1 6 pts. 9,684
  7. Avatar for matt61ger 77. matt61ger Lv 1 6 pts. 9,664
  8. Avatar for pfirth 78. pfirth Lv 1 5 pts. 9,636
  9. Avatar for RWoodcock 79. RWoodcock Lv 1 5 pts. 9,616
  10. Avatar for Simek 80. Simek Lv 1 5 pts. 9,615

Comments