Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Protein structural analysis room Japan 16. Protein structural analysis room Japan 1 pt. 8,186
  7. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129
  1. Avatar for django2 121. django2 Lv 1 1 pt. 8,077
  2. Avatar for Detektivbyranfan 122. Detektivbyranfan Lv 1 1 pt. 8,047
  3. Avatar for Ciccioinspalla98 123. Ciccioinspalla98 Lv 1 1 pt. 8,026
  4. Avatar for kaylut 124. kaylut Lv 1 1 pt. 7,899
  5. Avatar for lalotazmania 125. lalotazmania Lv 1 1 pt. 7,884
  6. Avatar for ume 126. ume Lv 1 1 pt. 7,753
  7. Avatar for Bohai Ruan 127. Bohai Ruan Lv 1 1 pt. 7,673
  8. Avatar for kehoescience 128. kehoescience Lv 1 1 pt. 7,638
  9. Avatar for Siegie 129. Siegie Lv 1 1 pt. 7,601
  10. Avatar for Phyx 130. Phyx Lv 1 1 pt. 7,529

Comments