Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  7. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129

  1. Avatar for macnacwullie 131. macnacwullie Lv 1 1 pt. 7,525
  2. Avatar for 01010011111 132. 01010011111 Lv 1 1 pt. 7,515
  3. Avatar for ken_663 133. ken_663 Lv 1 1 pt. 7,491
  4. Avatar for Jaibo14 134. Jaibo14 Lv 1 1 pt. 7,383
  5. Avatar for fiendish_ghoul 135. fiendish_ghoul Lv 1 1 pt. 7,024
  6. Avatar for vosemata 136. vosemata Lv 1 1 pt. 6,259
  7. Avatar for Toekan121 137. Toekan121 Lv 1 1 pt. 6,216
  8. Avatar for coolking295 138. coolking295 Lv 1 1 pt. 6,215
  9. Avatar for Bryce7421 139. Bryce7421 Lv 1 1 pt. 6,070
  10. Avatar for GhostsDontWalk 140. GhostsDontWalk Lv 1 1 pt. 6,046

Comments