2089: Revisiting Puzzle 96: Collagen
Closed since over 4 years ago
Novice Overall PredictionSummary
- Created
- December 30, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA
Top groups
Comments