Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  7. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129

  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 9 pts. 8,961
  2. Avatar for Beany 62. Beany Lv 1 9 pts. 8,923
  3. Avatar for Larini 63. Larini Lv 1 8 pts. 8,922
  4. Avatar for ProfVince 64. ProfVince Lv 1 8 pts. 8,892
  5. Avatar for vybi 65. vybi Lv 1 7 pts. 8,883
  6. Avatar for Arne Heessels 66. Arne Heessels Lv 1 7 pts. 8,873
  7. Avatar for Trajan464 67. Trajan464 Lv 1 7 pts. 8,859
  8. Avatar for DScott 68. DScott Lv 1 6 pts. 8,825
  9. Avatar for pfirth 69. pfirth Lv 1 6 pts. 8,807
  10. Avatar for vuvuvu 70. vuvuvu Lv 1 6 pts. 8,777

Comments