Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241
  1. Avatar for JanTheConqueror 141. JanTheConqueror Lv 1 1 pt. 5,872
  2. Avatar for wrightbiology 142. wrightbiology Lv 1 1 pt. 5,857
  3. Avatar for Erikkka 143. Erikkka Lv 1 1 pt. 4,278
  4. Avatar for AllSeeingEye13 144. AllSeeingEye13 Lv 1 1 pt. 3,129
  5. Avatar for ROOZEBOOM 145. ROOZEBOOM Lv 1 1 pt. 3,129
  6. Avatar for kotenok2000 146. kotenok2000 Lv 1 1 pt. 3,129
  7. Avatar for Diana200816 147. Diana200816 Lv 1 1 pt. 3,129
  8. Avatar for fpc 148. fpc Lv 1 1 pt. 3,129
  9. Avatar for RAH 149. RAH Lv 1 1 pt. 3,129
  10. Avatar for _markus0255 150. _markus0255 Lv 1 1 pt. 3,129

Comments