Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241

  1. Avatar for okaits7534 111. okaits7534 Lv 1 1 pt. 8,186
  2. Avatar for franklin99 112. franklin99 Lv 1 1 pt. 8,176
  3. Avatar for krzycho7 113. krzycho7 Lv 1 1 pt. 8,173
  4. Avatar for Antoinette Nguyen 114. Antoinette Nguyen Lv 1 1 pt. 8,165
  5. Avatar for RULIGAMER123 115. RULIGAMER123 Lv 1 1 pt. 8,164
  6. Avatar for furi0us 116. furi0us Lv 1 1 pt. 8,116
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 8,114
  8. Avatar for froschi2 118. froschi2 Lv 1 1 pt. 8,113
  9. Avatar for drumpeter18yrs9yrs 119. drumpeter18yrs9yrs Lv 1 1 pt. 8,093
  10. Avatar for Pinx 120. Pinx Lv 1 1 pt. 8,087

Comments