Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for Team China 14. Team China 1 pt. 8,874
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  6. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  7. Avatar for pikem125 18. pikem125 1 pt. 8,613

  1. Avatar for Sammy3c2b1a0 141. Sammy3c2b1a0 Lv 1 1 pt. 7,974
  2. Avatar for Sandra Villaluz 142. Sandra Villaluz Lv 1 1 pt. 7,909
  3. Avatar for Lord_Sandwich 143. Lord_Sandwich Lv 1 1 pt. 7,104
  4. Avatar for qz1014123 144. qz1014123 Lv 1 1 pt. 6,344
  5. Avatar for MultiColors 146. MultiColors Lv 1 1 pt. 6,026
  6. Avatar for litoguemi 147. litoguemi Lv 1 1 pt. 5,761
  7. Avatar for Raaaffy 148. Raaaffy Lv 1 1 pt. 5,739
  8. Avatar for BENJALIPO 149. BENJALIPO Lv 1 1 pt. 5,734
  9. Avatar for Juan Carlos Vega 150. Juan Carlos Vega Lv 1 1 pt. 5,608

Comments