Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for Team China 14. Team China 1 pt. 8,874
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  6. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  7. Avatar for pikem125 18. pikem125 1 pt. 8,613

  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 73 pts. 10,763
  2. Avatar for Lotus23 12. Lotus23 Lv 1 71 pts. 10,761
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 69 pts. 10,758
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 66 pts. 10,758
  5. Avatar for jausmh 15. jausmh Lv 1 64 pts. 10,757
  6. Avatar for silent gene 16. silent gene Lv 1 62 pts. 10,751
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 60 pts. 10,744
  8. Avatar for MicElephant 18. MicElephant Lv 1 58 pts. 10,736
  9. Avatar for jobo0502 19. jobo0502 Lv 1 56 pts. 10,724
  10. Avatar for Aubade01 20. Aubade01 Lv 1 54 pts. 10,721

Comments