Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 73 pts. 10,763
  2. Avatar for Lotus23 12. Lotus23 Lv 1 71 pts. 10,761
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 69 pts. 10,758
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 66 pts. 10,758
  5. Avatar for jausmh 15. jausmh Lv 1 64 pts. 10,757
  6. Avatar for silent gene 16. silent gene Lv 1 62 pts. 10,751
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 60 pts. 10,744
  8. Avatar for MicElephant 18. MicElephant Lv 1 58 pts. 10,736
  9. Avatar for jobo0502 19. jobo0502 Lv 1 56 pts. 10,724
  10. Avatar for Aubade01 20. Aubade01 Lv 1 54 pts. 10,721

Comments