Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for frostschutz 71. frostschutz Lv 1 7 pts. 9,582
  2. Avatar for DScott 72. DScott Lv 1 6 pts. 9,571
  3. Avatar for Wiz kid 73. Wiz kid Lv 1 6 pts. 9,565
  4. Avatar for Larini 74. Larini Lv 1 6 pts. 9,550
  5. Avatar for Arne Heessels 75. Arne Heessels Lv 1 5 pts. 9,539
  6. Avatar for Dr.Sillem 76. Dr.Sillem Lv 1 5 pts. 9,524
  7. Avatar for pfirth 77. pfirth Lv 1 5 pts. 9,502
  8. Avatar for tracybutt 78. tracybutt Lv 1 5 pts. 9,500
  9. Avatar for pizpot 79. pizpot Lv 1 4 pts. 9,490
  10. Avatar for AlphaFold2 80. AlphaFold2 Lv 1 4 pts. 9,458

Comments